Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated
This Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
DDIT3 upstream open reading frame protein; Alternative DDIT3 protein; AltDDIT3; DDIT3
UniProt
P0DPQ6
Expression Region
1-34
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL519071V 500 µL Each
Grap2 Mouse shRNA Lentiviral Particle (Locus ID 17444)
Sign In for Pricing
View Details 