Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37), Biotinylated

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1D-37 IGKV1D-37

UniProt

P0DSN7

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAMEF16 (NM_001045480) Human Over-expression Lysate
LC420754 20 µg

PRAMEF16 (NM_001045480) Human Over-expression Lysate

Sign In for Pricing
View Details
C1orf69 Polyclonal Antibody
orb1419854 100 µL

C1orf69 Polyclonal Antibody

Sign In for Pricing
View Details
Human Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit
EKL55300 96 Tests

Human Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana F-box/LRR-repeat protein At1g48400 (At1g48400)
MBS1437795-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana F-box/LRR-repeat protein At1g48400 (At1g48400)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana F-box/LRR-repeat protein At1g48400 (At1g48400)
MBS1437795-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana F-box/LRR-repeat protein At1g48400 (At1g48400)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana F-box/LRR-repeat protein At1g48400 (At1g48400)
MBS1437795-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana F-box/LRR-repeat protein At1g48400 (At1g48400)

Sign In for Pricing
View Details