Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 9 (SCGR9), Biotinylated

This Recombinant Human Small cysteine and glycine repeat-containing protein 9 (SCGR9), Biotinylated spans the amino acid sequence from region 1-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 9; Keratin-associated protein 28-1 pseudogene; SCYGR9 KRTAP28p1

UniProt

P0DSO2

Expression Region

1-92

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGSCGCSGGCGGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCSSCGCGCGKGCCQQKSCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR147 Human qPCR Primer Pair (MI0000262)
HP300163 200 Reactions

MIR147 Human qPCR Primer Pair (MI0000262)

Sign In for Pricing
View Details
(R,S)-Equol
TRC-E593000-50MG 50 mg

(R,S)-Equol

Sign In for Pricing
View Details
Mouse Cldn4 activation kit by CRISPRa
GA200754 1 Kit

Mouse Cldn4 activation kit by CRISPRa

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), 0.2mg/mL
BNUB2221-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), 0.2mg/mL

Sign In for Pricing
View Details
N-Phenyldiethanolamine
TRC-N234540-1G 1 g

N-Phenyldiethanolamine

Sign In for Pricing
View Details
HMG1 (HMGB1) (NM_002128) Human Over-expression Lysate
LC400775 20 µg

HMG1 (HMGB1) (NM_002128) Human Over-expression Lysate

Sign In for Pricing
View Details