Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6G Polyclonal Conjugated Antibody
orb1626944 100 µL

PDE6G Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
RISC-loading complex subunit TARBP2 (TARBP2) Rat ELISA Kit
G8187 96 Tests

RISC-loading complex subunit TARBP2 (TARBP2) Rat ELISA Kit

Sign In for Pricing
View Details
Stathmin-3 Polyclonal Antibody
UB-GEN-4140 100 µL

Stathmin-3 Polyclonal Antibody

Sign In for Pricing
View Details
Canine Pancpin (PANCPIN) ELISA Kit
MBS9907765-01 48 Well

Canine Pancpin (PANCPIN) ELISA Kit

Sign In for Pricing
View Details
Canine Pancpin (PANCPIN) ELISA Kit
MBS9907765-02 96 Well

Canine Pancpin (PANCPIN) ELISA Kit

Sign In for Pricing
View Details
Canine Pancpin (PANCPIN) ELISA Kit
MBS9907765-03 5x 96 Well

Canine Pancpin (PANCPIN) ELISA Kit

Sign In for Pricing
View Details