Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf60 Protein Vector (Human) (pPM-C-HA)
13706021 500 ng

C11orf60 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Olr635 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7380006 1.0 µg DNA

Olr635 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PAS1C1 Polyclonal Antibody, PE Conjugated
bs-9031R-PE 100 µL

PAS1C1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
(E) -3- (Cyclopent-1-en-1-yl) acrylonitrile
RG-E140174-01 10 mg

(E) -3- (Cyclopent-1-en-1-yl) acrylonitrile

Sign In for Pricing
View Details
(E) -3- (Cyclopent-1-en-1-yl) acrylonitrile
RG-E140174-02 25 mg

(E) -3- (Cyclopent-1-en-1-yl) acrylonitrile

Sign In for Pricing
View Details
(E) -3- (Cyclopent-1-en-1-yl) acrylonitrile
RG-E140174-03 50 mg

(E) -3- (Cyclopent-1-en-1-yl) acrylonitrile

Sign In for Pricing
View Details