Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vasoactive Intestinal Peptide (VIP) ELISA Kit
orb1662848-01 48 Tests

Rat Vasoactive Intestinal Peptide (VIP) ELISA Kit

Sign In for Pricing
View Details
Rat Vasoactive Intestinal Peptide (VIP) ELISA Kit
orb1662848-02 96 Tests

Rat Vasoactive Intestinal Peptide (VIP) ELISA Kit

Sign In for Pricing
View Details
5-Hydroxy Omeprazole- (Pyridyl) -d3
436671 1 mg

5-Hydroxy Omeprazole- (Pyridyl) -d3

Sign In for Pricing
View Details
Cenexin1 Recombinant Antibody, FITC Conjugated
bsm-62040R-FITC 100 µL

Cenexin1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Human TSPAN8 Protein, His Tag
TS8-H52H3-1mg 1 mg

Human TSPAN8 Protein, His Tag

Sign In for Pricing
View Details
IgM Antibody
orb436347 1 mg

IgM Antibody

Sign In for Pricing
View Details