Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511), Biotinylated spans the amino acid sequence from region 18-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 8-51-1 IGHV8-51-1

UniProt

P0DTE2

Expression Region

18-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EAQLTESGGDLVHLEGPLRLSCAASWFTFSIYEIHWVCQASGKGLEWVAVIWRGESHQYNADYVRGRLTTSRDNTKYMLYMQMISLRTQNMAAFNCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUOX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]
TA805869BM 100 µL

SUOX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]

Sign In for Pricing
View Details
Nudt16l2 Mouse Gene Knockout Kit (CRISPR)
KN500161 1 Kit

Nudt16l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Recombinant Monoclonal Mouse Antibody (rBN-34), CF®790 Conjugate - Biotium Choice
P033-790-1ML 1x 1 mL

Biotin Recombinant Monoclonal Mouse Antibody (rBN-34), CF®790 Conjugate - Biotium Choice

Sign In for Pricing
View Details
trans-Hydroxy Perhexiline-d11 (Mixture of Diastereomers)
TRC-H948912-1MG 1 mg

trans-Hydroxy Perhexiline-d11 (Mixture of Diastereomers)

Sign In for Pricing
View Details
Fibrillin 1 (FBN1) Human Gene Knockout Kit (CRISPR)
KN418499 1 Kit

Fibrillin 1 (FBN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), 1mg/mL
BNUM2151-50 1x 50 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), 1mg/mL

Sign In for Pricing
View Details