Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511), Biotinylated spans the amino acid sequence from region 18-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 8-51-1 IGHV8-51-1

UniProt

P0DTE2

Expression Region

18-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EAQLTESGGDLVHLEGPLRLSCAASWFTFSIYEIHWVCQASGKGLEWVAVIWRGESHQYNADYVRGRLTTSRDNTKYMLYMQMISLRTQNMAAFNCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH4A1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
11737151 3x 1.0 µg DNA

ALDH4A1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Cycloneroside A
TN10736-01 10 mg

Cycloneroside A

Sign In for Pricing
View Details
Cycloneroside A
TN10736-02 50 mg

Cycloneroside A

Sign In for Pricing
View Details
PRSS1 Antibody
orb2683342-01 50 µL

PRSS1 Antibody

Sign In for Pricing
View Details
PRSS1 Antibody
orb2683342-02 100 µL

PRSS1 Antibody

Sign In for Pricing
View Details
PRSS1 Antibody
orb2683342-03 200 µL

PRSS1 Antibody

Sign In for Pricing
View Details