Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein HRURF (HRURF), Biotinylated

This Recombinant Human Protein HRURF (HRURF), Biotinylated spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HRURF; HR upstream open reading frame protein; HRURF U2HR

UniProt

P0DUH7

Expression Region

1-34

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQPTASAQKLVRPIRAVCRILQIPESDPSNLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB1P49 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV763031 1.0 µg DNA

HMGB1P49 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit
201-12-2503 96 Tests

Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit

Sign In for Pricing
View Details
Ntn5 (NM_001033356) Mouse Untagged Clone
MC216058 10 µg

Ntn5 (NM_001033356) Mouse Untagged Clone

Sign In for Pricing
View Details
Porcine Short-Chain Fatty Acids ELISA Kit
GTR10376016 96 Well

Porcine Short-Chain Fatty Acids ELISA Kit

Sign In for Pricing
View Details
Phospho-AKT1 (Ser129) Rabbit Polyclonal Antibody (BF680)
orb1605351 100 µL

Phospho-AKT1 (Ser129) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
S6K1/RPS6KB1 Rabbit Polyclonal Antibody (Fluoro647)
orb3113923 100 µg

S6K1/RPS6KB1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details