Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetrapeptide repeat homeobox protein 2 (TPRX2), Biotinylated

This Recombinant Human Tetrapeptide repeat homeobox protein 2 (TPRX2), Biotinylated spans the amino acid sequence from region 1-301. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tetrapeptide repeat homeobox protein 2 TPRX2

UniProt

P0DV77

Expression Region

1-301

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQDPGHLQGPPLALDPPRRQRQERTVYTESQQKVLEFYFQKDQYPNYDQRLNLAEMLSLREQQLQVWFKNRRAKLARERRLQQQPQRVPGQRGRGARAAPLVPVAAASFPGGPEFPQGRGSWISPQPGPWGVLPAAEPKIYSLPRTWGGPECGTQEGLKAVPAPGPGPIPAPIPGPAQIPGPVPGPAPNLGPMSGPLSVSIPGPIPAPISCPGPIPDPVLGRTLMPGPGSLPTPAPGALWPQSPYASNLSPDTQLYPDFTKLLPLLDRFEESSLSTTTSQYKEEDGFVDKNHSVPRSLLDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF-21 Recombinant Protein
91-203 0.05 mg

FGF-21 Recombinant Protein

Sign In for Pricing
View Details
PGBD2 Rabbit Polyclonal Antibody
E53P02834 100 µL

PGBD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SOX7 Antibody Picoband® Fluoro594 Conjugated
PA2285-Fluoro594 100 µg/Vial

Anti-SOX7 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
PSIP1 (PC4 and SFRS1 Interacting Protein 1, DFS70, LEDGF, MGC74712, PAIP, PSIP2, p52, p75) (MaxLight 550)
250569-ML550 100 µL

PSIP1 (PC4 and SFRS1 Interacting Protein 1, DFS70, LEDGF, MGC74712, PAIP, PSIP2, p52, p75) (MaxLight 550)

Sign In for Pricing
View Details
Daf-16 Antibody
orb799143 2 mg

Daf-16 Antibody

Sign In for Pricing
View Details
2',5'-Dideoxyadenosine
C04223 5 mg

2',5'-Dideoxyadenosine

Sign In for Pricing
View Details