Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1), Biotinylated

This Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1), Biotinylated spans the amino acid sequence from region 1-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative Wilms tumor upstream neighbor 1 gene protein; WIT-1; Wilms tumor-associated antisense RNA; WT1-AS WIT1

UniProt

Q06250

Expression Region

1-92

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Caspase-9 Antibody [Alexa Fluor 594]
NBP1-76961AF594 0.1 mL

Rabbit Polyclonal Caspase-9 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
STNL P010-297x420-AL-CRD/1 AC Signs
823090 Card of 1 Pictogram(s)

STNL P010-297x420-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
BHLHE40 Rabbit pAb (APR26611N)
APR26611N-01 50 µL

BHLHE40 Rabbit pAb (APR26611N)

Sign In for Pricing
View Details
BHLHE40 Rabbit pAb (APR26611N)
APR26611N-02 100 µL

BHLHE40 Rabbit pAb (APR26611N)

Sign In for Pricing
View Details
BHLHE40 Rabbit pAb (APR26611N)
APR26611N-03 200 µL

BHLHE40 Rabbit pAb (APR26611N)

Sign In for Pricing
View Details
Human GIP Antibody
E55A13780 100 µg

Human GIP Antibody

Sign In for Pricing
View Details