Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human XK-related protein 6 (XKR6), partial, Biotinylated

This Recombinant Human XK-related protein 6 (XKR6), partial, Biotinylated spans the amino acid sequence from region 494-641. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XK-related protein 6 XKR6 C8orf21 C8orf5 C8orf7 XRG6

UniProt

Q5GH73

Expression Region

494-641

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptase Alpha / Beta-1 (TPSAB1) Antibody
abx132093-01 100 µL

Tryptase Alpha / Beta-1 (TPSAB1) Antibody

Sign In for Pricing
View Details
Tryptase Alpha / Beta-1 (TPSAB1) Antibody
abx132093-02 200 µL

Tryptase Alpha / Beta-1 (TPSAB1) Antibody

Sign In for Pricing
View Details
Tryptase Alpha / Beta-1 (TPSAB1) Antibody
abx132093-03 1 mL

Tryptase Alpha / Beta-1 (TPSAB1) Antibody

Sign In for Pricing
View Details
TNMD Polyclonal Antibody, HRP Conjugated
bs-7525R-HRP-TR 20 µL

TNMD Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
7-Methyl-3-[ (methylamino) methyl]-5H,6H,7H,8H-[1,2,4]triazolo[4,3-a]pyrazin-8-one dihydrochloride
UID62899-01 250 mg

7-Methyl-3-[ (methylamino) methyl]-5H,6H,7H,8H-[1,2,4]triazolo[4,3-a]pyrazin-8-one dihydrochloride

Sign In for Pricing
View Details
7-Methyl-3-[ (methylamino) methyl]-5H,6H,7H,8H-[1,2,4]triazolo[4,3-a]pyrazin-8-one dihydrochloride
UID62899-02 2.5 g

7-Methyl-3-[ (methylamino) methyl]-5H,6H,7H,8H-[1,2,4]triazolo[4,3-a]pyrazin-8-one dihydrochloride

Sign In for Pricing
View Details