Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G2 (O8G2P), partial, Biotinylated

This Recombinant Human Olfactory receptor 8G2 (O8G2P), partial, Biotinylated spans the amino acid sequence from region 1-41. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 8G2; Olfactory receptor 8G4; Olfactory receptor OR11-292; Olfactory receptor TPCR120; OR8G2P OR8G2 OR8G4

UniProt

Q6IF36

Expression Region

1-41

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Oryza sativa subsp. japonica (Rice) YSL18 Polyclonal Antibody
MBS9005733 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) YSL18 Polyclonal Antibody

Sign In for Pricing
View Details
HS3ST1 AAV Vector (Rat) (CMV)
23910106 1 µg

HS3ST1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Rat F13b Pre-designed siRNA Set B
SI204690B 1 Each

Rat F13b Pre-designed siRNA Set B

Sign In for Pricing
View Details
GHSR Conjugated Antibody
orb1625941 100 µL

GHSR Conjugated Antibody

Sign In for Pricing
View Details
Monkey Anti-Hepatitis B Surface Antigen Pres-S2 (HB-Pre-S2) IgG ELISA kit, 96 tests, quantitative
4450 1 Kit

Monkey Anti-Hepatitis B Surface Antigen Pres-S2 (HB-Pre-S2) IgG ELISA kit, 96 tests, quantitative

Sign In for Pricing
View Details
Netrin-1 (A-7) : m-IgGκ BP-HRP Bundle
sc-525398 1 Kit

Netrin-1 (A-7) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details