Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 9 (TRGV9), Biotinylated

This Recombinant Human T cell receptor gamma variable 9 (TRGV9), Biotinylated spans the amino acid sequence from region 21-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 9 TRGV9 TCRGV9

UniProt

Q99603

Expression Region

21-122

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

96-Well Round Capped Silicone Sealing Mats, for Sealing 96-Well Collection Plates (2.0 mL), Pierceable
96WSC20 1 Package

96-Well Round Capped Silicone Sealing Mats, for Sealing 96-Well Collection Plates (2.0 mL), Pierceable

Sign In for Pricing
View Details
Ran BP-10 siRNA (h)
sc-93126 10 µM

Ran BP-10 siRNA (h)

Sign In for Pricing
View Details
K0090, CT (EMC1, KIAA0090, ER membrane protein complex subunit 1) (MaxLight 550)
MBS6311869-01 0.1 mL

K0090, CT (EMC1, KIAA0090, ER membrane protein complex subunit 1) (MaxLight 550)

Sign In for Pricing
View Details
K0090, CT (EMC1, KIAA0090, ER membrane protein complex subunit 1) (MaxLight 550)
MBS6311869-02 5x 0.1 mL

K0090, CT (EMC1, KIAA0090, ER membrane protein complex subunit 1) (MaxLight 550)

Sign In for Pricing
View Details
Aire 3'UTR GFP Stable Cell Line
TU151596 1.0 mL

Aire 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Goat Kinetochore Protein NUF2 (NUF2) ELISA Kit
MBS9903702 Inquire

Goat Kinetochore Protein NUF2 (NUF2) ELISA Kit

Sign In for Pricing
View Details