Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 9 (TRGV9), Biotinylated

This Recombinant Human T cell receptor gamma variable 9 (TRGV9), Biotinylated spans the amino acid sequence from region 21-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 9 TRGV9 TCRGV9

UniProt

Q99603

Expression Region

21-122

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV687892 1.0 µg DNA

MANF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
2- (3-Methoxyphenyl) -2-oxoacetic acid
283757-01 25 mg

2- (3-Methoxyphenyl) -2-oxoacetic acid

Sign In for Pricing
View Details
2- (3-Methoxyphenyl) -2-oxoacetic acid
283757-02 50 mg

2- (3-Methoxyphenyl) -2-oxoacetic acid

Sign In for Pricing
View Details
2- (3-Methoxyphenyl) -2-oxoacetic acid
283757-03 100 mg

2- (3-Methoxyphenyl) -2-oxoacetic acid

Sign In for Pricing
View Details
2- (3-Methoxyphenyl) -2-oxoacetic acid
283757-04 250 mg

2- (3-Methoxyphenyl) -2-oxoacetic acid

Sign In for Pricing
View Details
2- (3-Methoxyphenyl) -2-oxoacetic acid
283757-05 500 mg

2- (3-Methoxyphenyl) -2-oxoacetic acid

Sign In for Pricing
View Details