Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative pro-MCH-like protein 2 (MCHL2), Biotinylated

This Recombinant Human Putative pro-MCH-like protein 2 (MCHL2), Biotinylated spans the amino acid sequence from region 1-86. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative pro-MCH-like protein 2; Pro-melanin-concentrating hormone-like protein 2; PMCHL2

UniProt

Q9BQD1

Expression Region

1-86

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Leukotriene B4, LT-B4 GENLISA ELISA
KLR0139 96 Well

Rat Leukotriene B4, LT-B4 GENLISA ELISA

Sign In for Pricing
View Details
FHOD1 Lentiviral Activation Particles (h2)
sc-404286-LAC-2 200 µL

FHOD1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Genorise® recombinant Bovine VEGF-B
GR120066 5 µg

Genorise® recombinant Bovine VEGF-B

Sign In for Pricing
View Details
Anti-ARRDC5 Antibody
MBS8322849-01 0.03 mL

Anti-ARRDC5 Antibody

Sign In for Pricing
View Details
Anti-ARRDC5 Antibody
MBS8322849-02 0.05 mL

Anti-ARRDC5 Antibody

Sign In for Pricing
View Details
Anti-ARRDC5 Antibody
MBS8322849-03 0.1 mL

Anti-ARRDC5 Antibody

Sign In for Pricing
View Details