Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative pro-MCH-like protein 2 (MCHL2), Biotinylated

This Recombinant Human Putative pro-MCH-like protein 2 (MCHL2), Biotinylated spans the amino acid sequence from region 1-86. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative pro-MCH-like protein 2; Pro-melanin-concentrating hormone-like protein 2; PMCHL2

UniProt

Q9BQD1

Expression Region

1-86

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIH1D1 (PIH1 Domain-containing Protein 1, Nucleolar Protein 17 Homolog, NOP17, FLJ20643) (MaxLight 750) discontinued
131333-ML750 100 µL

PIH1D1 (PIH1 Domain-containing Protein 1, Nucleolar Protein 17 Homolog, NOP17, FLJ20643) (MaxLight 750) discontinued

Sign In for Pricing
View Details
COX11 Polyclonal Antibody
UB-GEN-2481 100 µL

COX11 Polyclonal Antibody

Sign In for Pricing
View Details
Rabgap1l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4711805 3x 1.0 µg

Rabgap1l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Canine Tripeptidyl-Peptidase 2 (TPP2) ELISA Kit
MBS9912695-01 48 Well

Canine Tripeptidyl-Peptidase 2 (TPP2) ELISA Kit

Sign In for Pricing
View Details
Canine Tripeptidyl-Peptidase 2 (TPP2) ELISA Kit
MBS9912695-02 96 Well

Canine Tripeptidyl-Peptidase 2 (TPP2) ELISA Kit

Sign In for Pricing
View Details
Canine Tripeptidyl-Peptidase 2 (TPP2) ELISA Kit
MBS9912695-03 5x 96 Well

Canine Tripeptidyl-Peptidase 2 (TPP2) ELISA Kit

Sign In for Pricing
View Details