Recombinant Human Cold shock domain-containing protein C2 (CSDC2), Biotinylated
This Recombinant Human Cold shock domain-containing protein C2 (CSDC2), Biotinylated spans the amino acid sequence from region 1-153. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cold shock domain-containing protein C2; RNA-binding protein PIPPin; CSDC2 PIPPIN
UniProt
Q9Y534
Expression Region
1-153
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4808703 1.0 µg DNA
Tubgcp5 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details