Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1), Biotinylated

This Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1), Biotinylated spans the amino acid sequence from region 1-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein KIF25-AS1; KIF25 antisense RNA 1; KIF25 antisense gene protein 1; Protein HGC6.1; KIF25-AS1 C6orf54 NCRNA00300

UniProt

Q9Y6Z4

Expression Region

1-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGDIFKNNGVLQGRLRAVACAPHCFGPRLRCLHHDQGLTELAWGTWPHSHPVRHQPQMPSARECCSIVCMAAKEVSAPKAPGSPWMVPGDVAMSGHRVGALDERGHPNPQTGHCRGGSVSVTWSSVSCCRGRLAAVRVMIARDPSTCHLAKGCSPAWGFLPQARGPAGTRTPQRRCSSHEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POP4 Polyclonal Antibody
E55A04879 100 µg

POP4 Polyclonal Antibody

Sign In for Pricing
View Details
Human Olfactory receptor 5C1 (OR5C1) ELISA Kit
abx537061 96 Tests

Human Olfactory receptor 5C1 (OR5C1) ELISA Kit

Sign In for Pricing
View Details
FLG Antibody
orb534615-01 20 µg

FLG Antibody

Sign In for Pricing
View Details
FLG Antibody
orb534615-02 100 µg

FLG Antibody

Sign In for Pricing
View Details
FLG Antibody
orb534615-03 100 ug (without BSA and Azide)

FLG Antibody

Sign In for Pricing
View Details
Mitofusin 1 Rabbit Monoclonal Antibody
AMRe04129-01 1 Each

Mitofusin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details