Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1), Biotinylated

This Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1), Biotinylated spans the amino acid sequence from region 1-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein KIF25-AS1; KIF25 antisense RNA 1; KIF25 antisense gene protein 1; Protein HGC6.1; KIF25-AS1 C6orf54 NCRNA00300

UniProt

Q9Y6Z4

Expression Region

1-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGDIFKNNGVLQGRLRAVACAPHCFGPRLRCLHHDQGLTELAWGTWPHSHPVRHQPQMPSARECCSIVCMAAKEVSAPKAPGSPWMVPGDVAMSGHRVGALDERGHPNPQTGHCRGGSVSVTWSSVSCCRGRLAAVRVMIARDPSTCHLAKGCSPAWGFLPQARGPAGTRTPQRRCSSHEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRIT1 Recombinant Protein (Human)
RP067047 100 µg

KRIT1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)
MBS1065387-01 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)
MBS1065387-02 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)
MBS1065387-03 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)
MBS1065387-04 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)
MBS1065387-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial (At5g08300)

Sign In for Pricing
View Details