Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 265 (TM265), partial, Biotinylated

This Recombinant Human Transmembrane protein 265 (TM265), partial, Biotinylated spans the amino acid sequence from region 1-33. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 265 TMEM265

UniProt

A0A087WTH1

Expression Region

1-33

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEEKAVEILGNTEAAHPPSPIRCCWLRLRCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amer2 (NM_001164705) Mouse Tagged Lenti ORF Clone
MR207536L4 10 µg

Amer2 (NM_001164705) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GAL3ST3 Rabbit Polyclonal Antibody
orb325554 100 µL

GAL3ST3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CENPA Protein Lysate 20ug
IHUCENPAPLLY20UG 20 µg

Human CENPA Protein Lysate 20ug

Sign In for Pricing
View Details
RPL17P21 sgRNA CRISPR Lentivector (Human) (Target 3)
K1914404 1.0 µg DNA

RPL17P21 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Goat Alpha-lactalbumin (LALBA)
MBS965307-01 0.02 mg (E-Coli)

Recombinant Goat Alpha-lactalbumin (LALBA)

Sign In for Pricing
View Details
Recombinant Goat Alpha-lactalbumin (LALBA)
MBS965307-02 0.1 mg (E-Coli)

Recombinant Goat Alpha-lactalbumin (LALBA)

Sign In for Pricing
View Details