Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B), Biotinylated

This Recombinant Human Beta-defensin 131B (D131B), Biotinylated spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cacna1d, NT (Voltage-dependent L-type Calcium Channel Subunit alpha-1D, Calcium Channel, L Type, alpha-1 Polypeptide, Isoform 2, Rat Brain Class D, RBD, Voltage-gated Calcium Channel Subunit alpha Cav1.3, Cach3, Cacn4, Cacnl1a2, Cchl1a2) (Biotin) discontinued
029431-Biotin 100 µL

Cacna1d, NT (Voltage-dependent L-type Calcium Channel Subunit alpha-1D, Calcium Channel, L Type, alpha-1 Polypeptide, Isoform 2, Rat Brain Class D, RBD, Voltage-gated Calcium Channel Subunit alpha Cav1.3, Cach3, Cacn4, Cacnl1a2, Cchl1a2) (Biotin) discontinued

Sign In for Pricing
View Details
Hcrt sgRNA CRISPR Lentivector set (Mouse)
K5029201 3x 1.0 µg

Hcrt sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
EAAT1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb916413 100 µL

EAAT1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
USP11 (C-6) : m-IgG Fc BP-HRP Bundle
sc-529389 1 Kit

USP11 (C-6) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) DNAT Polyclonal Antibody
MBS7177908 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) DNAT Polyclonal Antibody

Sign In for Pricing
View Details
Fcgr4 (NM_144559) Mouse Tagged ORF Clone
MG203178 10 µg

Fcgr4 (NM_144559) Mouse Tagged ORF Clone

Sign In for Pricing
View Details