Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01), Biotinylated

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01), Biotinylated spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 1 (CLDN1) (C-term) rabbit polyclonal antibody, Aff - Purified
AP08878PU-N 125 µL

Claudin 1 (CLDN1) (C-term) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)
MBS1169750-01 0.02 mg (E-Coli)

Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)
MBS1169750-02 0.1 mg (E-Coli)

Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)
MBS1169750-03 0.02 mg (Yeast)

Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)
MBS1169750-04 0.1 mg (Yeast)

Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)
MBS1169750-05 0.02 mg (Baculovirus)

Recombinant Mycoplasma pneumoniae UPF0134 protein MPN_138 (MPN_138)

Sign In for Pricing
View Details