Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01), Biotinylated

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01), Biotinylated spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diisodecyl Phthalate (mixture of branched chain isomers)
447050-01 10 mL

Diisodecyl Phthalate (mixture of branched chain isomers)

Sign In for Pricing
View Details
Diisodecyl Phthalate (mixture of branched chain isomers)
447050-02 50 mL

Diisodecyl Phthalate (mixture of branched chain isomers)

Sign In for Pricing
View Details
Mouse Monoclonal MED6 Antibody (OTI3C9) [Alexa Fluor 750]
NBP2-72620AF750 0.1 mL

Mouse Monoclonal MED6 Antibody (OTI3C9) [Alexa Fluor 750]

Sign In for Pricing
View Details
KIAA1751 AAV Vector (Human) (CMV)
25640101 1 µg

KIAA1751 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
D8 THC (D8-THC-COOH) (HRP)
226906 500 µL

D8 THC (D8-THC-COOH) (HRP)

Sign In for Pricing
View Details
Gpn3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6293306 1.0 µg DNA

Gpn3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details