Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP), Biotinylated

This Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP), Biotinylated spans the amino acid sequence from region 1-734. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Casein kinase II subunit alpha'-interacting protein; Casein kinase 2 alpha prime interacting protein; CSNK2A2IP CSNKA2IP

UniProt

A0A1B0GTH6

Expression Region

1-734

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPLAYYGQHFVPLDYFYQLSSANTLTHQHTGEKLNQFNNQPMAKVQSHSNHFAVPPLGSNKKVQRCSVLPSPKSQDKISQSFCDRFLNSPLFHAKHQNTPSIGLHWRSSLWPAQRALNSHLLHSKAQTTSSSDLNMTSSLELNQAALSLQLPFCKPQTTSSSLDVCWRSLSLKSHQRVSSSSLFRLQNQEIPSINIIWTSSSLGPKRKALSSTLLQSKPQKTSSLDYLWTSSLQRNQRSLSSPSLNTKLQTSDLFWTSPSFKPNQIALTSPLLDSRLQKTPILNSNPTIGGLPVSHSKARQSASSYFVHPSENLPLFQLNSQSMFMLDCNFQTTNSPVCHSKFQNTTSPNGKHRVTHLPSPHPKTNISGQLLSSSKHCTRNTAASTLGFRLQSKSSFQFSPKTESNKEIPWTLKYSQPCIVKGGTVPDDVVNKIVNSISNTRIQRDLCRQILFRRMRGRPNPHPGPRLSSNYVVCLACASCLKSPCNHLRGKKNPHCATLSVIPTPEANSEGKIEVKLVLILSLPETFSSCLPFPMKENQPNEVPEDNLEGVEKIQQFFPTSERDIQGLNMKQIWWAVAPENKVIGQQPQAIDWLFYVKKNNSQPQSLLPSTSSSTSSSSTTSSSSSVASASSDSSSSSSSSSSFSISSSSSPSKEFMTLTLSRPVFRKVLSYHRLPAGVSWLEFIYSKDYQLHPRKPNRSQSSSLKTKPVRNNNTVKWRKGANTLFKFFRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS701161 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL
BNC470774-500 1x 500 µL

HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant BAT3 Monoclonal Antibody
E-AB-81460-01 50 µL

Recombinant BAT3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant BAT3 Monoclonal Antibody
E-AB-81460-02 100 µL

Recombinant BAT3 Monoclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-, 1mL 40nm
GP-1102-40 1 mL

Colloidal Gold Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-, 1mL 40nm

Sign In for Pricing
View Details
Human CD200, C-His Tag (ECD)
HA210665-01 20 µg

Human CD200, C-His Tag (ECD)

Sign In for Pricing
View Details