Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated

This Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMM50 (Sorting and Assembly Machinery Component 50 Homolog, Transformation-related Gene 3 Protein, OMP85, SAM50, TOB55, TRG-3, CGI-51, YNL026W) (Biotin)
MBS6436673-01 0.1 mL

SAMM50 (Sorting and Assembly Machinery Component 50 Homolog, Transformation-related Gene 3 Protein, OMP85, SAM50, TOB55, TRG-3, CGI-51, YNL026W) (Biotin)

Sign In for Pricing
View Details
SAMM50 (Sorting and Assembly Machinery Component 50 Homolog, Transformation-related Gene 3 Protein, OMP85, SAM50, TOB55, TRG-3, CGI-51, YNL026W) (Biotin)
MBS6436673-02 5x 0.1 mL

SAMM50 (Sorting and Assembly Machinery Component 50 Homolog, Transformation-related Gene 3 Protein, OMP85, SAM50, TOB55, TRG-3, CGI-51, YNL026W) (Biotin)

Sign In for Pricing
View Details
Cytomegalovirus
bsm-72095M 100 µg

Cytomegalovirus

Sign In for Pricing
View Details
Human MEST / Mesoderm-Specific Transcript Homolog Protein Recombinant Protein
MBS2903351 Inquire

Human MEST / Mesoderm-Specific Transcript Homolog Protein Recombinant Protein

Sign In for Pricing
View Details
DEET
C6750-1000 1 g

DEET

Sign In for Pricing
View Details
Recombinant Nodulation protein J (nodJ)
MBS1128534 Inquire

Recombinant Nodulation protein J (nodJ)

Sign In for Pricing
View Details