Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated

This Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluoro-4-hydroxy-3-methoxybenzaldehyde
PC1021961 250 mg

2-Fluoro-4-hydroxy-3-methoxybenzaldehyde

Sign In for Pricing
View Details
St8sia3 AAV siRNA Pooled Vector
45657166 1.0 µg

St8sia3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Goat Neuron Specific Enolase ELISA Kit
MBS037593 Inquire

Goat Neuron Specific Enolase ELISA Kit

Sign In for Pricing
View Details
Ubqlnl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3615708 1.0 µg DNA

Ubqlnl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
SLC16A13 sgRNA CRISPR Lentivector (Human) (Target 1)
K2170202 1.0 µg DNA

SLC16A13 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Cbl (MaxLight 750) discontinued
C2097-95-ML750 100 µL

Cbl (MaxLight 750) discontinued

Sign In for Pricing
View Details