Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated

This Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ANGPTL8 Protein, N-His
E55P2625 50 µg

Recombinant Human ANGPTL8 Protein, N-His

Sign In for Pricing
View Details
(Z) -1-Chloro-2-nonene
sc-501069 2.5 mg

(Z) -1-Chloro-2-nonene

Sign In for Pricing
View Details
GCN2iB
C13791-10mM/1mL 10 mM/1mL

GCN2iB

Sign In for Pricing
View Details
TINAGL1 CRISPRa sgRNA lentivector (set of three targets)(Human)
46734121 3x 1.0µg DNA

TINAGL1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
RIF1 Polyclonal Antibody
orb616506-01 50 μL

RIF1 Polyclonal Antibody

Sign In for Pricing
View Details
RIF1 Polyclonal Antibody
orb616506-02 100 µL

RIF1 Polyclonal Antibody

Sign In for Pricing
View Details