Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 48 (TEX48), Biotinylated

This Recombinant Human Testis-expressed protein 48 (TEX48), Biotinylated spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 48 TEX48

UniProt

A0A1B0GUV7

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,6-Dibromo Olivetol
TRC-B999563-1G 1 g

4,6-Dibromo Olivetol

Sign In for Pricing
View Details
4',6,7-Trihydroxyisoflavone
TRC-T795360-50MG 50 mg

4',6,7-Trihydroxyisoflavone

Sign In for Pricing
View Details
Tris(triphenylphosphine)rhodium(I) Chloride
TRC-T886465-1G 1 g

Tris(triphenylphosphine)rhodium(I) Chloride

Sign In for Pricing
View Details
SSNA1 Human Gene Knockout Kit (CRISPR)
KN401557 1 Kit

SSNA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF®440 Hydrazide
#96064 1x 1 mg

CF®440 Hydrazide

Sign In for Pricing
View Details
TICAM2 (TMED7-TICAM2) Rabbit Polyclonal Antibody
TA361122 100 µL

TICAM2 (TMED7-TICAM2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details