Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 48 (TEX48), Biotinylated

This Recombinant Human Testis-expressed protein 48 (TEX48), Biotinylated spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 48 TEX48

UniProt

A0A1B0GUV7

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Alanyl-L-alanyl-L-alanine
TRC-A576393-500MG 500 mg

L-Alanyl-L-alanyl-L-alanine

Sign In for Pricing
View Details
2-Pyrrolidinylphosphonic Acid
TRC-P991855-10MG 10 mg

2-Pyrrolidinylphosphonic Acid

Sign In for Pricing
View Details
TROP2 Mouse Monoclonal Antibody [A5E2]
HA600068 100 µL

TROP2 Mouse Monoclonal Antibody [A5E2]

Sign In for Pricing
View Details
EPPIN-WFDC6 Rabbit Polyclonal Antibody
TA371334 100 µL

EPPIN-WFDC6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Alox8 activation kit by CRISPRa
GA200169 1 Kit

Mouse Alox8 activation kit by CRISPRa

Sign In for Pricing
View Details
Human RNF39 activation kit by CRISPRa
GA112944 1 Kit

Human RNF39 activation kit by CRISPRa

Sign In for Pricing
View Details