Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 48 (TEX48), Biotinylated

This Recombinant Human Testis-expressed protein 48 (TEX48), Biotinylated spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 48 TEX48

UniProt

A0A1B0GUV7

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX18P3 Protein Vector (Human) (pPM-C-His)
PV132541 500 ng

SNX18P3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
TBS Buffer 1X, pH 7.4, Endotoxin Free
40121074-2 500 mL

TBS Buffer 1X, pH 7.4, Endotoxin Free

Sign In for Pricing
View Details
RSRC2 (D-3) Alexa Fluor® 546
sc-515073 AF546 200 µg/mL

RSRC2 (D-3) Alexa Fluor® 546

Sign In for Pricing
View Details
BSG Protein (C-His, Cynomolgus)
P522436 100 µg

BSG Protein (C-His, Cynomolgus)

Sign In for Pricing
View Details
ARPC1A Rabbit pAb (APR18243N)
APR18243N-01 50 µL

ARPC1A Rabbit pAb (APR18243N)

Sign In for Pricing
View Details
ARPC1A Rabbit pAb (APR18243N)
APR18243N-02 100 µL

ARPC1A Rabbit pAb (APR18243N)

Sign In for Pricing
View Details