Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf97 (CK097), Biotinylated

This Recombinant Human Uncharacterized protein C11orf97 (CK097), Biotinylated spans the amino acid sequence from region 1-126. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C11orf97 C11orf97

UniProt

A0A1B0GVM6

Expression Region

1-126

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTGEEAVVVTAVVAPKAGREEEQPPPPAGLGCGARGEPGRGPLEHGQQWKKFLYCEPHKRIKEVLEEERHIKRDECHIKNPAAVALEGIWSIKRNLPVGGLKPGLPSRNSLLPQAKYYSRHGGLRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Protein traB (traB)
MBS1187910-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Protein traB (traB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traB (traB)
MBS1187910-02 0.02 mg (Yeast)

Recombinant Escherichia coli Protein traB (traB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traB (traB)
MBS1187910-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Protein traB (traB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traB (traB)
MBS1187910-04 0.1 mg (Yeast)

Recombinant Escherichia coli Protein traB (traB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traB (traB)
MBS1187910-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Protein traB (traB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traB (traB)
MBS1187910-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli Protein traB (traB)

Sign In for Pricing
View Details