Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Methyl-CpG-binding domain protein 3-like 2B (MB3LB), Biotinylated

This Recombinant Human Methyl-CpG-binding domain protein 3-like 2B (MB3LB), Biotinylated spans the amino acid sequence from region 1-204. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Methyl-CpG-binding domain protein 3-like 2B MBD3L2B

UniProt

A0A1B0GVZ6

Expression Region

1-204

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARRAEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-3,6-difluorobenzamide
PC5286-01 1 g

2-Chloro-3,6-difluorobenzamide

Sign In for Pricing
View Details
2-Chloro-3,6-difluorobenzamide
PC5286-02 5 g

2-Chloro-3,6-difluorobenzamide

Sign In for Pricing
View Details
Rasl2-9-ps Protein Vector (Mouse) (pPM-C-HA)
PV222616 500 ng

Rasl2-9-ps Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TMX1 Polyclonal Antibody
RD81959A-01 60 μL

TMX1 Polyclonal Antibody

Sign In for Pricing
View Details
TMX1 Polyclonal Antibody
RD81959A-02 120 μL

TMX1 Polyclonal Antibody

Sign In for Pricing
View Details
TMX1 Polyclonal Antibody
RD81959A-03 200 µL

TMX1 Polyclonal Antibody

Sign In for Pricing
View Details