Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Forkhead box protein L3 (FOXL3), Biotinylated

This Recombinant Human Forkhead box protein L3 (FOXL3), Biotinylated spans the amino acid sequence from region 1-233. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Forkhead box protein L3 FOXL3

UniProt

A0A1W2PRP0

Expression Region

1-233

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFDSSQYPYNCFNYDADDYPAGSSDEDKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRSEGHEKGKGNYWTFAGGCESLLDLFENGNYRRRRRRRGPKREGPRGPRAGGAQGPSGPSEPPAAQGRLAPDSAGEGAPGREPPASPAPPGKEHPRDLKFSIDYILSSPDPFPGLKPPCLAQEGRYPRLENVGLHFWTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEX2 (NM_001172087) Human Over-expression Lysate
LY432857 100 µg

PEX2 (NM_001172087) Human Over-expression Lysate

Sign In for Pricing
View Details
Protein G Coated - 96 well Solid plates - Black PS
MCB09F-PG 10x 96 Well Plates

Protein G Coated - 96 well Solid plates - Black PS

Sign In for Pricing
View Details
HOXD9 (NM_014213) Human Recombinant Protein
TP306492 20 µg

HOXD9 (NM_014213) Human Recombinant Protein

Sign In for Pricing
View Details
IPTG, 5 g
#10021-2 1x 5 g

IPTG, 5 g

Sign In for Pricing
View Details
iFluor™ 647 Conjugated Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]
HA720142F 100 µL

iFluor™ 647 Conjugated Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]

Sign In for Pricing
View Details
FOLR1, AlpHcAbs® Human
HA710333 100 µg

FOLR1, AlpHcAbs® Human

Sign In for Pricing
View Details