Recombinant Human Small cysteine and glycine repeat-containing protein 1 (SCGR1), Biotinylated
This Recombinant Human Small cysteine and glycine repeat-containing protein 1 (SCGR1), Biotinylated spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Small cysteine and glycine repeat-containing protein 1; Keratin-associated protein 28-1; SCYGR1 KRTAP28-1
UniProt
A0A286YEY9
Expression Region
1-88
Origin
Homo sapiens (Human)
Field of Research
Pharmacology & Drug Discovery
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MGCCGCGGCGGCGGCGGGCGGGCGRCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCSSCGYSCGKGCCQQKCCCQKQCCC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
125697 100 µg
DDAH1 (N (G), N (G) -dimethylarginine Dimethylaminohydrolase 1, DDAH-1, Dimethylarginine Dimethylaminohydrolase 1, DDAHI, Dimethylargininase-1, DDAH)
Sign In for Pricing
View Details 
GTR15337685 1 Vial
Lentiviral human ABLIM2 shRNA (UAS) - Lentiviral human ABLIM2 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details