Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5), Biotinylated

This Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5), Biotinylated spans the amino acid sequence from region 1-85. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 5; Keratin-associated protein 28-5; SCYGR5 KRTAP28-5

UniProt

A0A286YF46

Expression Region

1-85

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCCSCGCGCGKGCCQQKGCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) ; Clone LHK15
RA0625-C.5 0.5 mL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) ; Clone LHK15

Sign In for Pricing
View Details
PDI polyclonal antibody
BS91043 50ul

PDI polyclonal antibody

Sign In for Pricing
View Details
NEDD9 Adenovirus (Human)
31686051 1.0 mL

NEDD9 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Aeromonas Salmonicida arnE Protein
VAng-Lsx1517-inquire Inquire

Recombinant Aeromonas Salmonicida arnE Protein

Sign In for Pricing
View Details
Anti-PARP10 antibody
STJ114681 100 µl

Anti-PARP10 antibody

Sign In for Pricing
View Details
ATP2B4 Human Recombinant Protein
TP726021 50 µg

ATP2B4 Human Recombinant Protein

Sign In for Pricing
View Details