Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 271 (TM271), partial, Biotinylated

This Recombinant Human Transmembrane protein 271 (TM271), partial, Biotinylated spans the amino acid sequence from region 240-385. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 271 TMEM271

UniProt

A0A286YF58

Expression Region

240-385

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNYKSSQARRGRRGRRRGGRALARPRGGSGLRAQPPASRARRGRRGRRGRRLQQRPSEASILSPEESDLAAPGDCAGFAAHHAVSYINVGVLHALDEAGAEVRCGGHPSVELPGYAPSDPDLNASYPYCCRPPCETPRPWETHRAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey IgG (H&L) Antibody Peroxidase
TA398081 1 mg

Monkey IgG (H&L) Antibody Peroxidase

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit
RD-TNFaIP6-Mu-01 96 Tests

Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit
RD-TNFaIP6-Mu-02 48 Tests

Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit

Sign In for Pricing
View Details
GLI-3 Antibody
8C10328-AAT 50 µg

GLI-3 Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (H1), 0.2mg/mL
BNUB0334-500 1x 500 µL

Cytokeratin 8 (H1), 0.2mg/mL

Sign In for Pricing
View Details
Rpl30 Rabbit Polyclonal Antibody
TA363106 100 µL

Rpl30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details