Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 8 (SCGR8), Biotinylated

This Recombinant Human Small cysteine and glycine repeat-containing protein 8 (SCGR8), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 8; Keratin-associated protein 28-8; SCYGR8 KRTAP28-8

UniProt

A0A286YFG1

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGGCGGCSGGCGGGCGGGCGGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCSSCGCGYGKGCCQQKGCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF9 Mouse Monoclonal Antibody [Clone ID: OTI15C9]
CF813220 100 µg

TNFSF9 Mouse Monoclonal Antibody [Clone ID: OTI15C9]

Sign In for Pricing
View Details
CBP (Acetyl-Lys1535) Antibody
8D0019-AAT 50 µg

CBP (Acetyl-Lys1535) Antibody

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NTR/912), CF594 conjugate, 0.1mg/mL
BNC940912-100 1x 100 µL

NGFR (Nerve Growth Factor Receptor) (NTR/912), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HypoGel® 400 COOH
SP40011015003.100G 100 g

HypoGel® 400 COOH

Sign In for Pricing
View Details
SPlink HRP Broad Spectrum DAB Detection Kit
D01-6 6 mL

SPlink HRP Broad Spectrum DAB Detection Kit

Sign In for Pricing
View Details
VC Lambda / EcoR I Marker (ready-to-use), 5 x 50µg
NM2404 5 x 50μg

VC Lambda / EcoR I Marker (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details