Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 3 (OOSP3), Biotinylated

This Recombinant Human Oocyte-secreted protein 3 (OOSP3), Biotinylated spans the amino acid sequence from region 23-193. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 3 OOSP3

UniProt

A0A2R8YFM6

Expression Region

23-193

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVSVGCTSSMFWVVAEPTLLGQDHILHSDEASLGTGCPVTNVTAKGYEFNYPATQCGIQKEVFSYVTVFYSALHCNIMHKGVTGKIPLMCIVYGSSLDTTSSTIHNNLTEFQNDPPATNSYSPWNLTNASLFGLTRIPYFQNSSVEASHQSLLLNMSHPLVHESANVAIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF562 Polyclonal Antibody
28750-01 50 µL

ZNF562 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF562 Polyclonal Antibody
28750-02 100 µL

ZNF562 Polyclonal Antibody

Sign In for Pricing
View Details
OR4K11P AAV Vector (Human) (CMV)
35231101 1 µg

OR4K11P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Ku70 (pS5) Blocking Peptide
abx161757-01 1 mg

Ku70 (pS5) Blocking Peptide

Sign In for Pricing
View Details
Ku70 (pS5) Blocking Peptide
abx161757-02 5 mg

Ku70 (pS5) Blocking Peptide

Sign In for Pricing
View Details
Phospho-MCM2/MCM2 Rabbit Monoclonal Antibody
orb1147446 100 µL

Phospho-MCM2/MCM2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details