Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NFIL3 like protein (NFILZ), Biotinylated

This Recombinant Human NFIL3 like protein (NFILZ), Biotinylated spans the amino acid sequence from region 1-289. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NFIL3 like protein; NFIL3 like basic leucine zipper; NFILZ

UniProt

A0A5F9ZHS7

Expression Region

1-289

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDVGFSGLPDVSQSHSKTLWGARGRGPSIRRQREFMPEEKKDTVYWEKRRKNNEAAKRSREKRRLNDAAIEGRLAALMEENALLKGELKALKLRFGLLPLTGGPRALPLQALLLEAPWTGDPRPGAEALSSLSGSHSCLLRPRSLDAGIPGCRGCLLAPRWTGLATSPRSPQESASPTLNRIDMALQTALPPALFSCHLLEGHVGSRPELRPCWGLWSPVPSGCRASGPSDVLLTPTADPMGLSPGVTCPAPGNSPEGLGQPSLPHKLRIKSRASGRVPRGWEGGQAPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pik3r6 Rat siRNA Oligo Duplex (Locus ID 497932)
SR500380 1 Kit

Pik3r6 Rat siRNA Oligo Duplex (Locus ID 497932)

Sign In for Pricing
View Details
FGF21 Rabbit Polyclonal Antibody (BF555)
orb2444068 100 µL

FGF21 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
PDCD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV649359 1.0 µg DNA

PDCD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
LOC634327 Mouse siRNA Oligo Duplex (Locus ID 634327)
SR418845 1 Kit

LOC634327 Mouse siRNA Oligo Duplex (Locus ID 634327)

Sign In for Pricing
View Details
Mouse Urgcp activation kit by CRISPRa
GA209074 1 Kit

Mouse Urgcp activation kit by CRISPRa

Sign In for Pricing
View Details
Macrophage Migration Inhibitory Factor (MIF) Antibody
abx377703-01 50 µg

Macrophage Migration Inhibitory Factor (MIF) Antibody

Sign In for Pricing
View Details