Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Taurine up-regulated 1 protein (TUG1), partial, Biotinylated

This Recombinant Human Taurine up-regulated 1 protein (TUG1), partial, Biotinylated spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Taurine up-regulated 1 protein TUG1

UniProt

A0A6I8PU40

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPPRRAPGGRWRSRRVFLLVRRTRAAAYAFAIRRGVVRVVGGGGQLLRPAPGEAAAAAAAGFGAAGEAGVAGAGLEAWRHPSGPARTQLGGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQCD Antibody
OC-2387-01 50 μL

IQCD Antibody

Sign In for Pricing
View Details
IQCD Antibody
OC-2387-02 100 µL

IQCD Antibody

Sign In for Pricing
View Details
IQCD Antibody
OC-2387-03 1 mL

IQCD Antibody

Sign In for Pricing
View Details
Mouse Pram1 Pre-designed siRNA Set A
SI111083A 1 Each

Mouse Pram1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ANKRD20A3 Protein Vector (Human) (pPB-His-MBP)
PV321978 500 ng

ANKRD20A3 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
C20orf46 discontinued
507477 100 µg

C20orf46 discontinued

Sign In for Pricing
View Details