Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 228 (RN228), partial, Biotinylated

This Recombinant Human RING finger protein 228 (RN228), partial, Biotinylated spans the amino acid sequence from region 1-235. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RING finger protein 228 RNF228

UniProt

A0A7I2V3R4

Expression Region

1-235

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAPASDSGGSQQSPSSSPGSREGAGVAAKGAPDCGDAGARDAAETVSGLPPLEDYECKICYNYFDADRRAPKLLACLHTFCQECLSQLQLRAAAAAAAAAAPERPPRPPPWLCPPGAIACPVCRHRTPLPDSRVHGLPNNTKLAEAFPLALRAAHDPLPQDRLPPLPARLPAPAAAPPPTPAPPPPPSPAPPQPPPPPPAEDAAPGPRARPGLRAPGAYDSCQNCKRAALTAGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM114A2 Adenovirus (Human)
19721051 1.0 mL

FAM114A2 Adenovirus (Human)

Sign In for Pricing
View Details
Nrip1 Mouse Gene Knockout Kit (CRISPR)
KN511234 1 Kit

Nrip1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vmn1r80 Protein Vector (Mouse) (pPB-C-His)
PV245906 500 ng

Vmn1r80 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Brilliant Violet 421™ anti-mouse CD45.2
GT01906 50 µg

Brilliant Violet 421™ anti-mouse CD45.2

Sign In for Pricing
View Details
IgG2a Isotype Control Fc fusion protein (FITC)
35R-0008 100 ug

IgG2a Isotype Control Fc fusion protein (FITC)

Sign In for Pricing
View Details
GRASP AAV Vector (Rat) (CMV)
22640106 1 µg

GRASP AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details