Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CEBPZOS (CEBOS), partial, Biotinylated

This Recombinant Human Protein CEBPZOS (CEBOS), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CEBPZOS; CEBPZ antisense RNA 1; CEBPZ opposite strand; CEBPZOS CEBPZ-AS1

UniProt

A8MTT3

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQKTWLNSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CYP11A1 Polyclonal Antibody
TMAB-00518-01 50 μL

Anti-CYP11A1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CYP11A1 Polyclonal Antibody
TMAB-00518-02 100 µL

Anti-CYP11A1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CYP11A1 Polyclonal Antibody
TMAB-00518-03 200 µL

Anti-CYP11A1 Polyclonal Antibody

Sign In for Pricing
View Details
BACH Antibody Blocking peptide
orb1447332 500 µg

BACH Antibody Blocking peptide

Sign In for Pricing
View Details
S100A12 Rabbit Polyclonal Antibody (Cy5.5)
orb1070429 100 µL

S100A12 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Fxr1 (NM_001012179) Rat Tagged Lenti ORF Clone
RR202526L3 10 µg

Fxr1 (NM_001012179) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details