Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142), Biotinylated

This Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142), Biotinylated spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein encoded by LINC02881; Long intergenic non-protein coding RNA 2881; LINC02881 C10orf142

UniProt

B7Z368

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRMYSSDAHERPPSPSLGTTPPHPLPPTGSPRPRQDSAAGNSEEREPRGLRRASGVGSSCKRPTVCMGRQQGLPFCTVCGYRCSSPERTRGRCAVGKVRVAGGGGAPGGGAGMRCCGCRERNINKELELF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor VIII Antibody
8C0187-AAT 50 µg

Factor VIII Antibody

Sign In for Pricing
View Details
n-Octyl Acrylate (Stabilized with MEHQ)
TRC-O294655-5ML 5 mL

n-Octyl Acrylate (Stabilized with MEHQ)

Sign In for Pricing
View Details
ST2 (IL1RL1) (NM_003856) Human Over-expression Lysate
LC401271 20 µg

ST2 (IL1RL1) (NM_003856) Human Over-expression Lysate

Sign In for Pricing
View Details
Homeo box C10 (HOXC10) Mouse Monoclonal Antibody [Clone ID: OTI5C10]
CF808880 100 µg

Homeo box C10 (HOXC10) Mouse Monoclonal Antibody [Clone ID: OTI5C10]

Sign In for Pricing
View Details
MON1A Human Gene Knockout Kit (CRISPR)
KN403028 1 Kit

MON1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KRBOX1 Human Gene Knockout Kit (CRISPR)
KN431738 1 Kit

KRBOX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details