Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UBAP1-MVB12-associated (UMAD1), Biotinylated

This Recombinant Human UBAP1-MVB12-associated (UMAD1), Biotinylated spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBAP1-MVB12-associated; UMA-domain containing protein 1; RPA3 antisense RNA 1; RPA3 opposite strand; UMAD1 RPA3-AS1 RPA3OS

UniProt

C9J7I0

Expression Region

1-137

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Gallbladder
CS602290 5x 5 µm

Frozen Tissue Sections, Gallbladder

Sign In for Pricing
View Details
Polyclonal antibodyPN1 polyclonal antibody
orb1725153-01 50 µL

Polyclonal antibodyPN1 polyclonal antibody

Sign In for Pricing
View Details
Polyclonal antibodyPN1 polyclonal antibody
orb1725153-02 100 µL

Polyclonal antibodyPN1 polyclonal antibody

Sign In for Pricing
View Details
Rat Neprilysin (NEP) ELISA Kit
RDR-NEP-Ra-96Tests 96 Tests

Rat Neprilysin (NEP) ELISA Kit

Sign In for Pricing
View Details
PR 619
sc-476324B 25 mg

PR 619

Sign In for Pricing
View Details
Recombinant Human Tubulin polymerization-promoting protein Protein, GST, E.coli-200ug
QP6830-ec-200ug 200ug

Recombinant Human Tubulin polymerization-promoting protein Protein, GST, E.coli-200ug

Sign In for Pricing
View Details