Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial, Biotinylated

This Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial, Biotinylated spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B4 NPIPB4

UniProt

C9JG80

Expression Region

1-62

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-500 1x 500 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL
BNC741205-100 1x 100 µL

Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF640R conjugate, 0.1mg/mL
BNC400823-500 1x 500 µL

P21 / WAF1 (CIP1/823), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF640R conjugate, 0.1mg/mL
BNC402007-500 1x 500 µL

MHC II, Mouse (MK-D6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details