Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial, Biotinylated

This Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial, Biotinylated spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B4 NPIPB4

UniProt

C9JG80

Expression Region

1-62

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf25 Human shRNA Plasmid Kit (Locus ID 80739)
TR319926 1 Kit

C6orf25 Human shRNA Plasmid Kit (Locus ID 80739)

Sign In for Pricing
View Details
Troponin T antibody (Cardiac)
MBS530622-01 1 mg

Troponin T antibody (Cardiac)

Sign In for Pricing
View Details
Troponin T antibody (Cardiac)
MBS530622-02 5x 1 mg

Troponin T antibody (Cardiac)

Sign In for Pricing
View Details
phospho-DOK1 (Tyr362) Polyclonal Antibody PE Conjugated
MBS9463796-01 0.1 mL

phospho-DOK1 (Tyr362) Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
phospho-DOK1 (Tyr362) Polyclonal Antibody PE Conjugated
MBS9463796-02 5x 0.1 mL

phospho-DOK1 (Tyr362) Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
SNX10 Antibody
orb1315126-01 30 µL

SNX10 Antibody

Sign In for Pricing
View Details