Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRAC2 (PRAC2), Biotinylated

This Recombinant Human Protein PRAC2 (PRAC2), Biotinylated spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein PRAC2; Prostate, rectum and colon expressed gene protein 2; PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

UniProt

D3DTV9

Expression Region

1-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGDIB Rabbit pAb
E2503740 100 µL

ARHGDIB Rabbit pAb

Sign In for Pricing
View Details
AKR1C3, ID (AKR1C3, DDH1, HSD17B5, KIAA0119, PGFS, Aldo-keto reductase family 1 member C3, 17-beta-hydroxysteroid dehydrogenase type 5, 3-alpha-HSD type II, brain, 3-alpha-hydroxysteroid dehydrogenase type 2, Chlordecone reductase homolog HAKRb, Dihydrodiol dehydrogenase 3, Dihydrodiol dehydrogenase type I, HA1753, Indanol dehydrogenase, Prostaglandin F synthase, Testosterone 17-beta-dehydrogenase 5, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (AP) discontinued
031744-AP 200 µL

AKR1C3, ID (AKR1C3, DDH1, HSD17B5, KIAA0119, PGFS, Aldo-keto reductase family 1 member C3, 17-beta-hydroxysteroid dehydrogenase type 5, 3-alpha-HSD type II, brain, 3-alpha-hydroxysteroid dehydrogenase type 2, Chlordecone reductase homolog HAKRb, Dihydrodiol dehydrogenase 3, Dihydrodiol dehydrogenase type I, HA1753, Indanol dehydrogenase, Prostaglandin F synthase, Testosterone 17-beta-dehydrogenase 5, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (AP) discontinued

Sign In for Pricing
View Details
Kinesis Rheodyne Loop 500ul SS 7125; 7010
CHR2675 1 Each

Kinesis Rheodyne Loop 500ul SS 7125; 7010

Sign In for Pricing
View Details
Anti-Ubiquitin/UBB Antibody Picoband® (HRP Conjugate)
PB9122-HRP 100 µg/Vial

Anti-Ubiquitin/UBB Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
LentimiRa-mmu-miR-219b-5p Vector
mm41246 500 ng

LentimiRa-mmu-miR-219b-5p Vector

Sign In for Pricing
View Details
KLRC3 Antibody (FITC)
orb516595-01 50 µg

KLRC3 Antibody (FITC)

Sign In for Pricing
View Details