Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRAC2 (PRAC2), Biotinylated

This Recombinant Human Protein PRAC2 (PRAC2), Biotinylated spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein PRAC2; Prostate, rectum and colon expressed gene protein 2; PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

UniProt

D3DTV9

Expression Region

1-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1627 antibody - N-terminal region (ARP50652_P050)
ARP50652_P050 100 µL

KIAA1627 antibody - N-terminal region (ARP50652_P050)

Sign In for Pricing
View Details
Human Heterotaxy 1 (HTX1) ELISA Kit
QY-E04876 96 Tests

Human Heterotaxy 1 (HTX1) ELISA Kit

Sign In for Pricing
View Details
RPL7AP50 3'UTR Luciferase Stable Cell Line
TU020543 1.0 mL

RPL7AP50 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-Zea mays (Maize) TUBB2 Polyclonal Antibody
MBS7153041 Inquire

Rabbit anti-Zea mays (Maize) TUBB2 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Glucose-6-Phosphatase Catalytic Subunit 1 (G6PC1) Protein
abx653553-01 10 µg

Rat Glucose-6-Phosphatase Catalytic Subunit 1 (G6PC1) Protein

Sign In for Pricing
View Details
Rat Glucose-6-Phosphatase Catalytic Subunit 1 (G6PC1) Protein
abx653553-02 50 µg

Rat Glucose-6-Phosphatase Catalytic Subunit 1 (G6PC1) Protein

Sign In for Pricing
View Details