Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRAC2 (PRAC2), Biotinylated

This Recombinant Human Protein PRAC2 (PRAC2), Biotinylated spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein PRAC2; Prostate, rectum and colon expressed gene protein 2; PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

UniProt

D3DTV9

Expression Region

1-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Prolactin
7-01420 10 µg

Recombinant Rat Prolactin

Sign In for Pricing
View Details
AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11)
A1334-70W7 100 µg

AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11)

Sign In for Pricing
View Details
Human TCC C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit
orb1714729-01 48 Tests

Human TCC C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Human TCC C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit
orb1714729-02 96 Tests

Human TCC C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human CRIP3 shRNA (UAS) - Lentiviral human CRIP3 shRNA (UAS, RFP) plasmid
GTR15139201 1 Vial

Lentiviral human CRIP3 shRNA (UAS) - Lentiviral human CRIP3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
FXYD6 sgRNA CRISPR Lentivector (Human) (Target 2)
K0824403 1.0 µg DNA

FXYD6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details